PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009136665.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 1904aa    MW: 209942 Da    PI: 6.6036
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009136665.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-1211291170346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                       +WT+eE e ++d  +++G++ +k+Ia+++   +t  +c+++++k
   XP_009136665.1 1129 PWTPEEKETFLDMLAMHGKD-FKKIASHLS-QKTTADCVEYYYK 1170
                       8*****************99.*********.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1511131174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-811201171IPR009057Homeodomain-like
PROSITE profilePS5129316.50411251176IPR017884SANT domain
SMARTSM007176.8E-1211261174IPR001005SANT/Myb domain
PfamPF002495.8E-1011281170IPR001005SANT/Myb domain
CDDcd001676.85E-911291171No hitNo description
PROSITE profilePS5129310.91613311382IPR017884SANT domain
SMARTSM007173.0E-513321380IPR001005SANT/Myb domain
SuperFamilySSF466895.77E-813351382IPR009057Homeodomain-like
CDDcd001671.20E-413361377No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1904 aa     Download sequence    Send to blast
MPQDHASWDR KELHRLRKRD RPSEPPPPFD SPPSPSSHRE FSRWGSASDF RRPNCNGKQG  60
GRYDFEEETS HGYTSSRSSA RMFENDYHRP LAPRGDWRYA RNFRDDRVPL SHKDWKCNTW  120
EMNSGSSRDF ERPFGVRNGR RSVDERPPHA SDTHTALVNS WDPPPNFTHQ PEMCTPVRTL  180
KFTNEHNNSD QRPSSLPIDP HSDRPSSENS YDNKECQTEN QCNGLMYARR LANDNSLDPP  240
IRNTELEGTR KPHLKDMPDN RLRGVGDLDG AMKSGKESSL GAVGKLPVWP QDHTSWDRKE  300
LLRPRKRERP SEPPFDSPSS HHVPREYSRW GSGDFRRPNC HGKQGGRYQF AEESSHDYYR  360
QSAPRGDWRY TRNCRDDRVP LSQKEKCSTL EMSNGSSRAF ERPCGVRNGR RSVDERPLHA  420
SDTHSTLVNS SDSPNSTHQP DIEMCNPVQT LKFKNEPKFS DQRPSLPIDP HSDCLSLFER  480
PTSEKSYENK ECSTANQSNG LMYARRLAND NSLDPPIRHA ELEGTRKQLH LENMEDNRLR  540
GVSDLEGTMK SGKESSLGAI GKLPVCSGSF SSQSSGFSHS SSFKSLGVGD SSDQKQKVLP  600
KIVAATQSSS GDATACATTT LSEEMISRKK RLGWGEGLAK YENKKVDVNT IEDGTALLEN  660
GTGELHSLNK NIAGESPTAA IAPGYGSPTT PSSVDCSSSP GFADKSSAKA AIGASDVSNI  720
CRSPSPVSSD YLERLPINIE ELDNVSMERF GCLLSELLGT DDPVIGDFSS AQLTSMNKLL  780
AWKGDILKAV EMAESEIDML ENKQKALKLE GGRQCRVVEP SSYLCQGDEN VSKKQESPCI  840
LGPEIVASSV AETLVRDPVH QAVSAKAPVE IFEDSPGEVK SLPQAFATVG SNEDSLRMPS  900
VRVVASSKAI NTSAVASQEA IDLFCADDMV SNEDLHCAKL LSTNKIYASE SSGVFNELLP  960
REFSSFDDSR FLGVRQRQFD SHVKEKIADR IELLRAREKI LLLRFKAFQL AWKKDLHQLA  1020
LTKYQPKSNK RTEVLPNAKI SGRLKLPQPL RLRLSSSAQR RDSVASTTEL VSYMKKLQNG  1080
TRLKPFRDIL RMPAMILDEK ERARSRFISS NGMIEDPCDV EKERTKINPW TPEEKETFLD  1140
MLAMHGKDFK KIASHLSQKT TADCVEYYYK NHKSDSFGKI KKQCGYGKEG KHTYMLAPRK  1200
KWNREMGAAS LDILGAVSII ASNAGKVAST RQISSKRITL RGSSSSSSLQ HDGKYSEGCS  1260
HSFGFPRNGN LGADVVAVGP LSSEQINSRE ECMYHLKIDP AAKKPRISHS TQNENSNEDE  1320
DSCSEESCEE TGPIHWTDAE RSAFIQGFSL FGKNFASLSS FVRTRSPDQC RVFFSKVRKC  1380
LGLECRQSGS ANVSTSASVD NANEGVGGSD LEDPCAMESN SAICNDGVSA KIGLNSPTSP  1440
FNMNQEGANH SGSANVEAGL SRSEQDIGLT LLCLKDGTSL VNNACINGDC PGLVSEPCRD  1500
LVNNDSVESQ CHAAEQINSN DPMSMEIDEG DLTSVAAEKI KSSDQLSMEI DEGNLTPIAV  1560
SSDPLYCGAS ALSGTIVETP TESSHKGSGG EGTALPNQSS TQQDGVIQAA NRAINYGLEA  1620
EAAPSSFRYP ECLHHVPIEE DLVDVSVPQG DPSCHTESEL SNSLVVQTNN VGWQFSEVNL  1680
NLDRRLRIVG HVKPEQSGRL NATSTEPCQI PWRSFTQDPS RIIRSKSDLI VNTQHTGEGF  1740
SLRKCTSSAT KPLTVFHKDG LSGHSRSHSF SLSDSERLDK NGDVKLFGTV LTADDNGSKQ  1800
KQNPGGSIRS SSTLSGDLQY INQQHLQNVP ITSYSFWDGS NIQTVLTSLP ESAKLLASYP  1860
EALSTHLKQQ IVSSKEIQLD VSGILSFGKH IEERADVSSG KDER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D6e-1710871177493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C6e-1710871177493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.239960.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136665.10.0PREDICTED: uncharacterized protein LOC103860750
TrEMBLM4D8K50.0M4D8K5_BRARP; Uncharacterized protein
STRINGBra012815.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein